MCQOPTIONS
Saved Bookmarks
MCQOPTIONS
This section includes 25 Mcqs, each offering curated multiple-choice questions to sharpen your Bioinformatics knowledge and support exam preparation. Choose a topic below to get started.
| 1. |
Match the entries in the Group Iwith the entries inGroup II. Group IGroup IIP. Threading1. Gene duplicationQ. FASTA2. Fold predictionR. Profile3. HMMS. Paralogs4. k-tuple |
| A. | P-2, Q-1, R-3, S-4 |
| B. | P-2, Q-4, R-3, S-1 |
| C. | P-3, Q-4, R-2, S-1 |
| D. | P-1, Q-4, R-3, S-2 |
| Answer» C. P-3, Q-4, R-2, S-1 | |
| 2. |
Consider the following multiple sequence alignment of four DNA sequences. A C T A A C T G A G T C A G C T Shannon's entropy of the above alignment is __ |
| A. | 3.80 - 3.82 bits |
| B. | 8.56 - 9.63 bits |
| C. | 2.02 - 2.98 bits |
| D. | 7.80 - 8.82 bits |
| Answer» B. 8.56 - 9.63 bits | |
| 3. |
Identify the file format given below: >Pl; JMFD Protein X Homo sapiens MKALTARQQEVFDLIRDHISRTLRQQGDWL |
| A. | GDE |
| B. | FASTA |
| C. | NBRF |
| D. | GCG |
| Answer» D. GCG | |
| 4. |
Determine the correctness or otherwise of the following Assertion (A) and Reason (R).Assertion: UPGMA method produces ultrametric tree. Reason:Sequence alignment is converted into evolutionary distances in UPGMA method. |
| A. | Both (A) and (R) are true and (R) is the correct reason for (A) |
| B. | Both (A) and (R) are true and (R) is not the correct reason for (A) |
| C. | (A) is true but (R) is false |
| D. | (A) is false but (R) is true |
| Answer» C. (A) is true but (R) is false | |
| 5. |
For prediction of three dimensional structure of protein (P) homology modeling tries many possible alignments (Q) threading first identifies homologues (R) threading evaluates many rough models (S) homology modeling optimizes one model |
| A. | Q, S |
| B. | P, Q |
| C. | R, S |
| D. | Q, R |
| Answer» D. Q, R | |
| 6. |
Match the methods available on world wide web in group 1 for performing the jobs listed in group 2 Group 1Group 2P. Boxshade1. Searching family data baseQ. BCM launcher2. Finding alignmentsR. Prosite3. Displaying alignmentsS. PSI-BLAST4. Searching for multiple alignments |
| A. | P-l, Q-3, R-2, S-4 |
| B. | P-2, Q-3, R-2, S-4 |
| C. | P-3, Q-4, R-l, S-4 |
| D. | P-3, Q-2, R-l, S-4 |
| Answer» E. | |
| 7. |
Match the item in Group I with an appropriate description in Group 2 : Group 1Group 2P. UPGMA1. Protein sequence databaseQ. CLUSTAL2. Phylogenetic analysisR. SWISS-PROT3. 3-D structure visualizationS. RasMOl4. Multiple sequence alignment |
| A. | P-4, Q-1, R-2, S-3 |
| B. | P-2, Q-4, R-1, S-3 |
| C. | P-2, Q-3, R-1, S-4 |
| D. | P-2, Q-1, R-4, S-3 |
| Answer» C. P-2, Q-3, R-1, S-4 | |
| 8. |
The algorithm for BLAST is based on |
| A. | Dynamic Programming |
| B. | Hidden Markov Model |
| C. | k-tuple analysis |
| D. | Neural Network |
| Answer» D. Neural Network | |
| 9. |
How many rooted and unrooted phylogenetic trees, respectively, are possible with four different sequences ? |
| A. | 3 and 15 |
| B. | 15 and 3 |
| C. | 15 and 12 |
| D. | 12 and 3 |
| Answer» C. 15 and 12 | |
| 10. |
An example of a derived protein structure database is |
| A. | Pfam |
| B. | SCOP |
| C. | GEO |
| D. | Prosite |
| Answer» C. GEO | |
| 11. |
Consider the following multiple sequence alignment of four DNA sequences. |
| A. | 3.80 - 3.82 bits |
| B. | 8.56 - 9.63 bits |
| C. | 2.02 - 2.98 bits |
| D. | 7.80 - 8.82 bits |
| Answer» B. 8.56 - 9.63 bits | |
| 12. |
Identify the file format given below: |
| A. | GDE |
| B. | FASTA |
| C. | NBRF |
| D. | GCG |
| Answer» D. GCG | |
| 13. |
Match the entries in the Group Iwith the entries inGroup II. |
| A. | P-2, Q-1, R-3, S-4 |
| B. | P-2, Q-4, R-3, S-1 |
| C. | P-3, Q-4, R-2, S-1 |
| D. | P-1, Q-4, R-3, S-2 |
| Answer» C. P-3, Q-4, R-2, S-1 | |
| 14. |
The amino acid substitution matrices in decreasing order of stringency for comparing protein sequences are |
| A. | PAM250, PAM120, PAM100 |
| B. | PAM100, PAM120, PAM250 |
| C. | PAM250, PAM100, PAM120 |
| D. | PAM120, PAM250, PAM100 |
| Answer» C. PAM250, PAM100, PAM120 | |
| 15. |
In an affine gap penalty model, if the gap opening penalty is -20, gap extension penalty is -4 and gap length is 8, the gap score is ___. |
| A. | - 30 to -5 |
| B. | - 40 to -40 |
| C. | - 52 to -52 |
| D. | - 65 to -40 |
| Answer» D. - 65 to -40 | |
| 16. |
The method used for prediction of three dimensional structure of a protein from known structure(s) of one or more related proteins is |
| A. | Multiple sequence alignment |
| B. | Homology modeling |
| C. | Phylogeny |
| D. | Docking |
| Answer» C. Phylogeny | |
| 17. |
The most widely used program for multiple sequence alignment is |
| A. | BLAST |
| B. | FASTA |
| C. | CLUSTAL |
| D. | Chime |
| Answer» D. Chime | |
| 18. |
The suitable substitution matrix to align closely related sequences is |
| A. | PAM 250 or BLOSSUM 80 |
| B. | PAM 40 or BLOSSUM 80 |
| C. | PAM 120 or BLOSSUM 40 |
| D. | PAM 250 or BLOSSUM 40 |
| Answer» C. PAM 120 or BLOSSUM 40 | |
| 19. |
Synteny refers to |
| A. | gene duplication from a common ancestor |
| B. | a tree representation of related sequences |
| C. | the extent of similarity between two sequences |
| D. | local conservation of gene order |
| Answer» E. | |
| 20. |
Accession number is a unique identification assigned to a |
| A. | single database entry for DNA/Protein |
| B. | single database entry for DNA only |
| C. | single database entry for Protein only |
| D. | multiple database entry for DNA/Protein |
| Answer» B. single database entry for DNA only | |
| 21. |
Program used for essentially local similarity search is |
| A. | BLAST |
| B. | RasMol |
| C. | ExPASY |
| D. | SWISS-PROT |
| Answer» B. RasMol | |
| 22. |
Match the methods available on world wide web in group 1 for performing the jobs listed in group 2 |
| A. | P-l, Q-3, R-2, S-4 |
| B. | P-2, Q-3, R-2, S-4 |
| C. | P-3, Q-4, R-l, S-4 |
| D. | P-3, Q-2, R-l, S-4 |
| Answer» E. | |
| 23. |
For prediction of three dimensional structure of protein |
| A. | Q, S |
| B. | P, Q |
| C. | R, S |
| D. | Q, R |
| Answer» D. Q, R | |
| 24. |
In bioinformatics, the term BLAST refers to |
| A. | database retrieval tool |
| B. | computational tool for sequence homology searching and alignment |
| C. | computational tool to view genomic sequences |
| D. | computational tool to view protein structures |
| Answer» C. computational tool to view genomic sequences | |
| 25. |
Match the item in Group I with an appropriate description in Group 2 : |
| A. | P-4, Q-1, R-2, S-3 |
| B. | P-2, Q-4, R-1, S-3 |
| C. | P-2, Q-3, R-1, S-4 |
| D. | P-2, Q-1, R-4, S-3 |
| Answer» C. P-2, Q-3, R-1, S-4 | |